SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|244593|SNAP_00012651 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|244593|SNAP_00012651
Domain Number 1 Region: 120-182
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000196
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|244593|SNAP_00012651
Sequence length 800
Sequence
MGCEPAIALLHFAKQDPKNSSDEPSETLQEGKIWSSLVCCLSLEMEQPHRQKRQLDWNGG
GKLYNYDHLALSSNSRPEHRSLPSLEEDYSADEDPVYVAGLSKSGLPGDPGIDYPILPSI
PLTDFHCRGRTPGFYGDTQTACQVFHVCDISGRQDSFLCPNGTIFSQKLFACDWWYNVQC
AATREHYQLNRNLFKGGDVNVYGTPSFWNWLSESEEEDVNPTAAPPTAAPKLRHHQTAGA
RKNKYIARPSPSSPVGPPFQLEQVTEPAAGIEQLPEPAPLVQSGPTQQFVEPVIDSVEFG
HINPPQLEPLGPPPQWESFVPEIQQAPVEPAQPPVPIAEDPDAAMMSQGFTSEYRNHYFS
WVNDAVHPGPHMAPELSWADLGPNGPLMTNPSSQLADEQQPTWQQPAEPVDRRRKAKPAA
QHTQNPIAVKRQTSSSRPATILVPAPQPPVFHPKPAPVQKQMTTPPKHVTQQAPPKSPKS
QLASSHSRTVPPPKFVTTIAPLPVLKPKSNKTKPKQRSSTVTIKTTTYAPLADQRYYSID
DNDDVTNHDDNSDNKPTNQKIRDVIARQTSRFGNRIKKAKKALQPLPVIQHPATAQHRQT
EAKQTQFVPSPKVMPIVPSPLVSISRADSTAANSLNWIPKLNQPATPYRTEPFWNHPVPA
QSRAIAQSPVPKPVASRPVVPSVGNAQRRSSTSETNHPAQVRTFEEFVASSPTTSAPFAA
QVRKTRISSSFRPSMPIPAVTTNSHQPRVRALRAHPPSTRARSGGKRRRKSNVAYDPRLD
RSYEPSHSIWKLQNWESTKI
Download sequence
Identical sequences E9GLB1
jgi|Dappu1|244593|SNAP_00012651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]