SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|244644|SNAP_00012702 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|244644|SNAP_00012702
Domain Number 1 Region: 141-240
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-18
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 2 Region: 27-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000393
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|244644|SNAP_00012702
Sequence length 265
Sequence
MTTWCLALSFLILSLLSSTYGSAIEPRACGGVLYVGDEDVIEAPFQENCKWQIQTDEKHV
LAFSLVHGGNFAAAQEFFSIHDGLDVIESENQIHHKVGLTSGESIDTFYTTSSEVEIRFK
KTPASPLKLKIQKRGQGNHTTYCSDNNMKLVSIEDNNEENTIYLAWVVNFWTSGTYNKTT
GIWTWSSTMANVSPGYTNWAPFEPNNTLVDGNCLTIKNGWYDDPCANLYDAVCESHPEDF
IVTTTESYYSTEEGTVTDEPSSISA
Download sequence
Identical sequences E9GLF1
jgi|Dappu1|244644|SNAP_00012702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]