SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|244996|SNAP_00013054 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|244996|SNAP_00013054
Domain Number 1 Region: 10-48
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000373
Family Pan module (APPLE domain) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|244996|SNAP_00013054
Sequence length 76
Sequence
MDPVIGPAVVVLATPVDKCGEACLANPECHHFTYTSSKGLCIILLKKTSYDLKAVTFPQL
SGSLCGYIPSRTRQPY
Download sequence
Identical sequences E9GMC8
jgi|Dappu1|244996|SNAP_00013054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]