SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|245751|SNAP_00013809 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|245751|SNAP_00013809
Domain Number - Region: 101-161
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000437
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|245751|SNAP_00013809
Sequence length 359
Sequence
MKSSNSVNQPFANKAGQQQPQSKEQTNVEIDDEDDEETYEEDPAVLFLLDICIGTGIFFL
CIAIASIVAIAIVSTYRVVERMAAVDVEPTPFRVVNHGIWPGYRHEFFNEKVPFIKAEQV
CSSREKASLLHFNSQEQEDQFDLYASLNFWSTTDYPAFQLWTSGFVLARRIESKPSLIVA
WPEPNAKGELIEIRECAVRGEGLVNAFSAHEKFWQERHIVKDYIMDNQPVGMDATGADGG
CWQHVKRNDMAPQSFYRFVCMRKMNKIMKLTWMLLLLAIVTASSVSSNLANVISDEISIK
KDHLVVMTAELTISRVSEDSKKFHRSPDRTGRRFTSDARLAFPSKQISVFDPEGQCYYP
Download sequence
Identical sequences E9GP00
jgi|Dappu1|245751|SNAP_00013809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]