SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|246514|SNAP_00014572 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|246514|SNAP_00014572
Domain Number - Region: 97-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|246514|SNAP_00014572
Sequence length 158
Sequence
MGLALITPEPGITTMRCKNLLCWRQESQYVIVRNASKTGPVRNGKVLSTTLWISTYKGEL
GRQDKFGRGVMDRLVKDIATPSTLKDSIQLIVHYEGSNPCLNSPCTPFCVLIPGGCPCSC
FDSTILVQSGGEMWDATEERTRPSPFALPLPESRGLHR
Download sequence
Identical sequences E9GQQ3
jgi|Dappu1|246514|SNAP_00014572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]