SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|247827|SNAP_00015885 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|247827|SNAP_00015885
Domain Number 1 Region: 408-520
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-24
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 2 Region: 2795-2995
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.7e-24
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number 3 Region: 537-636
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-23
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 4 Region: 1040-1193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.01
Further Details:      
 
Domain Number 5 Region: 221-371
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-22
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 6 Region: 1512-1661
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.27e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0058
Further Details:      
 
Domain Number 7 Region: 636-756
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-17
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 8 Region: 878-949
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 9 Region: 3348-3546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000803
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 10 Region: 1264-1327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000129
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 2561-2680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 2433-2563
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000659
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 13 Region: 365-405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 816-880
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000389
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 15 Region: 2290-2327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000621
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 16 Region: 935-996
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000834
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2101-2267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 18 Region: 2404-2446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000357
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 19 Region: 2701-2789
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000439
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 20 Region: 1401-1469
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000723
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 21 Region: 755-827
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000135
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 22 Region: 1196-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000164
Family EGF-type module 0.017
Further Details:      
 
Domain Number 23 Region: 2368-2411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.013
Further Details:      
 
Domain Number 24 Region: 3607-3648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000051
Family EGF-type module 0.022
Further Details:      
 
Domain Number 25 Region: 2255-2289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family EGF-type module 0.026
Further Details:      
 
Domain Number 26 Region: 991-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000879
Family EGF-type module 0.0093
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|247827|SNAP_00015885
Domain Number - Region: 2332-2368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000866
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1465-1509
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00598
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|247827|SNAP_00015885
Sequence length 3881
Sequence
MDPSDRLTVTLFNELLAKDGVRHMVEFASWPSATANQTQLPTTTDSIATKNEMRENVTTV
DWAKQNAKVDGRNDDMINGERLNPLAVQSSVFYKSRIIPGESSCVDWRDWQEIQMHGVSP
KGTILIPPFHGTPIFVRRIHLAVDASRVSRQTWAQEEEEEKEKPVGILHQMWWWWWRWPM
RAHLLFQSRDNRLMFRVESGSMMALRRCRVALLAALVLLASSSVRSQENELFHCPDGWRL
QGLHCYRFFEVQHSWERAADLCKRYGSDLVVVESYQQNNISEKLAQEQLNPVTHPDAAFW
LGLMSLDDLSTNTLEAASGSLVQQYAGFWQVDQPDARKGQCVRASTANADQSWALSSCES
LLPFVCRAKACPKNSFLCSNGRCINGALRCDTQDDCGDGSDENACPEECHYHMVSSGDSI
ESPNYPGKYRPLADCKWTLEGPVGTSIVLQFTEFDTERTFDTVQILAGGRTEYSSVTLAT
LSGKQNISTQFFTSASNFMIVRFRSDATVEKNGFRASWKTEPVSCGEHLKALPQGKELTS
PGYPQAYPGGLECLYVISAPLGKVVTLIIEDFDMEPHKDYVLIRNGPESDSEKLAMLTGR
SDELPTYLQSTTEAMYLYIHTDLSDSRKGFRFRYSVGCDLSLEAANGTLVSPGYDMETVD
FRYPNNLECDYRLRAPGGSPLSLRFAEFQVDDTDSVQLYDGSSSNGVALSPAEGFRGKTE
PKGATFSAHSGDLLIRFKSDALRNDRGWKIMFSADCAELLLDENAIVSSKQRIFGSNVTI
TCPPGMEFATGVKKIMTECLNGGRWSTPYIPKCQAVYCGPVPQIDNGFAIAATNVTFGGE
AQYQCYAGFGFSSGQAIETIRCTGDGQWDMVPQCSASQCTPLPEVSHANATNLNGGGMNY
GSVIRFECEPGYVRTGDPVLLCQSNGTWSGAVPSCSKIQCRTFPEIENGWVSNRTRTYFF
GDETRAQCYRGYKLNGTTVIRCGADGKFANVPTCLDVDECGGSGGSTSSSSPCDQASATC
TNVPGSFQCGCRSGFIPNLDCRPVVDLGLGNGGVPNPSISVSSAEKGFPKENVRLSTKGG
WCGAESGSGSNWVMIDFKAPTVLRGFRTQPVLRGSSGVAFASSIRLQYADDADDLFREYK
SPEGAPVEFRIPEGTSIAVVNLPTAIEARYFRLVIQDYSVAPCLRMEMMGCTRTECLDVD
ECAVANGSCQQKCINNPGGFACSCSQGYDLYTQNGTAGFHILDSETGLRDGDLYRINKTC
VKKMCPAVKSPENGHMLTTRASHHFGDEVNFHCRIGYIMVGARSIQCTAAGTWNASVPEC
QPAQCVSLADDQSEGLTVARSSPADNQLVPYGQNITLSCNEPGRPLVRTPTSSFRQCVYD
PRAGFPQYWFSGAQPSCPRIDCGKPSETPGAEYGFFPDTRYKSSFFFGCQPTFTLTGQSS
RNDNVVRCMENGVWDFGDLRCEGPVCEDPGRPADGIQLATSYEQGAEISFQCTRPGYIPI
TSAPIQCVREPECSVVRPIGITSGRIPDGSFNATSERRNYEARKARMNSATGWCAQQEEA
FTYVSVDLGTVHRVKVILVKGVVTNDVVGRPTEIRFFYKQDPSENFVVYFPNFNLTSRDP
GNYGELAMITLPLAVQARFVILGIVAYDKNPCLKFELMGCPDEPEEDRLLGYDLGYPVCV
DNDPPQFLNCPNSAIRVKRSAEGMGVVDFVVPTASDNSGMIARTEVRPEGFRPPLTVFQD
TMVEYFAYDFDGNVAICQINITVIDEEPPLLQCPQSFVIELVEPQESYQVFFNETRRRVV
VSDASGQDVAVTFIPESAFIRVGSYENVTVVATDPSGNQQKCYFQVSVQPTQCVDWELKA
PANGAINCLPPSNRPAGSGGLECVATCNPGFRFTDGEPVKSFRCDVKQPWTPGHVVPDCV
TEETQQAMYNVVAKVLYRAGAATAAIPATCLSQYTTVVRPFYQALDRALSARCSAISVDM
NVTFVESQTEMHLVEDNIAEITYVLSIMPAVRQPQLYDLCGSTLGLVFDLSVPSTSAVLA
PLLDLAATSNAECPPMKAVNSSLSRGFACGVGEVLNMPAAANVPRCLHCPAGTSALSGAK
SCALCPRGFYQDQEQSGSCKRCPAGTFTRSEGSKTVDECVPVCGFGTYSPTGLVPCLECP
RDSFTGTPPPGGFTDCQACPADAPFTHQPAAPSVATCRPKCAAGTYSVTGLAPCAACPNH
FFQPMEGKMSCVECPGSAMTVGTGAKSRDECQPLACKEGFCRNGGLCLAQTHMAYCYCPS
GFSGRFCEVNIDDCASQPCYNGGTCRDQEQGYLCSCPPGYSGLQCQDEESSCNATTCNDR
SMCKNEPGQGQFTCLCRTGYTGPNCSSTLDPCAENPCSNSAQCIPLKQGRFKCACPAGWE
GPLCDQNVDDCAESPCLLGSNCTDLVDDFSCSCPTGFTGKRCETKVDLCQPSPCGDHGQC
VDHYFNALCICQPGWTGPNCTAQVDECSSNPCLNGGQCQDVEGDYQCLCPLGFTGKNCQH
NVDYCGVQPCQHGGTCTDALESFQCQCRPGFLGVQCEIDIDECLDNPCDPVGTDRCLDQI
NKYHCQCRPGFTGTLCENKINECAPVSPCLNGGVCTELVNNFKCTCPAGWTGQRCEKDIS
FCESQPCLNNANCINLLGDFFCACPSGTDGKRCETAPDRCIGDPCMNQGHCRDFGSGLNC
TCDSDYVGVGCQHEFDACSVGVCQNGATCIDNGASYQCVCPDGFSGRHCEQDVVECVPGA
CPLSATCIDLIDDFYCRCPFNLTGEDCRKIVQTDYDFFFSDETRRASASLVVPFVLGSSS
LTLALWVQFTNRDDLGNILTLYSVESSSTLRNHRIMAQVHSSGVHIALLPGIKDVFLPFR
VNLAINDGQWHHIALVWDGPHGAITLTTDGVIVGRVENYGVNRTLSQFGWMTLGAPNSAG
KTRTEHGFHGHLTRVHLWGRPLDVITDIPKQVRSCQSAPMLFDGLLLQWSGYDRIERGVE
RVMPSACGQRVCPLGFSGPSCASLDKDKIPPQVVRCPSDIWIETRNGSARVDWNEPQFSD
NIRLAQVEETRGIRSGNTLAWGTYDVAYVAYDEAGNSAVCAFKIYIVNEFCPKLADPVGG
SQRCSDWGPGGRFKVCSIECNAGLAFSVPVPKFYTCGAEGFWRPTEDPGVSFVYPACSST
KPAQRIVKIKLQYLSSVLCNEAGQSVLSDKVRQAIQKLNRDWRFCNAKGSQSAICNDLNV
NIKCQRRHGDLGVKRRRQADVNDDVYDLEISFPAESDPVTNINTQEKSTIERLLETIILE
KDDFDVRDSLPTTVPDPATLSISADFTCPVGQVVRVSECVACAPGNAFDMEKKNCKPCRV
GTFQDQAGQTQCKICPVIAGRPGTTFASGARSATDCKERCPAGKFYSEETQRCLNCGFGH
YQAAEGSFACRSCQAGLTTRTDQAISADECSEECPTGLQLTSLSNNATCEPCPKGTYRTK
GREMACQPCPAGFTTTRSGSATVEECSEPKCQPGSALSKENTCVLCQVGSYQPNAQQTSC
LPCPPDTTTKLAGATLKSDCSNPCSPATNQTICPVNGVCLFVASTNVHRCECKAGFTPVP
PDSPTDFTCMDKCDNFCKNDGKCRRDRATGEPYCQCTGSYTGLQCEAQSNFAYIVGGSAG
FVVFLILLVLLIWMICARTSRRRDSQAKAAANAAVVAGDPSGSQANFYYGSHAPYAESIA
PSHHSTYAHYYDEEEDGWEMPNFYNETYMKAENLHNVNKGNSLARSNASLYGNKEELYDR
LRRHAYQGKKEKNGNETTSERIQVSSFFWTLNCRFPNVVERVIAKISFGRVGYAHPLLQF
VHYEMATYRLYSVVPRLVRFVDYHLYSCDALQHNTNFSHLL
Download sequence
Identical sequences E9GSY7
jgi|Dappu1|247827|SNAP_00015885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]