SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|247979|SNAP_00016037 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|247979|SNAP_00016037
Domain Number 1 Region: 310-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000304
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|247979|SNAP_00016037
Sequence length 482
Sequence
MASNENDNNNKPRARVWHVWFGSVSYRKISFAPKTQAEPSQAKQQHDKITLNVIEKKNHG
LVSCDVACDLERQSKEFFPMFSDILSESLCPAVLNNEGKTTTVAHSNLLGGNDEEKKVKF
EKFLTVSSSIPAGHCSWFLARIESGRVGHAMTEDEKQLAFEQLLGKTSRLRMAGSSQTSF
EATTIQPPTIATMSTAMPIMLSDEEAKRHDRRHAVHQPKKHNKKDHSKRQHHAGRHVCTH
EETITRPIRVVESYCKPAYKSFTQRCSNGTMCTAFRVQYDTIYRTVVKYQTTTEKKHACC
PGWTHTEKHTHGCLQGCKNGGTCVKPNTCNCAPGYTGPSCESGIVGNLSTVSNEQKIRLE
LVPELQTLLINYESMSKRLAALEQEPRVNSSPSQPHPAPQVDVIDYQSTIANMTDHIILL
EEKLNKLQNETTILIANSNNTVESSNNESLESLSEQVAILEERLADCTCTMAPVDNTVKT
RL
Download sequence
Identical sequences E9GTG4
jgi|Dappu1|247979|SNAP_00016037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]