SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|248514|SNAP_00016572 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|248514|SNAP_00016572
Domain Number - Region: 33-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000381
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|248514|SNAP_00016572
Sequence length 181
Sequence
MAGCCDYVVVVAANLRPKTTEQHCNINNKTTKTDLDECEVEDVEKNCAGTCINTIGSFRC
SEEDVASSQEDRQETENEEDDGEAAEAIQEAATSSSTQTSTTTSTTSTTPTTTTTSTIPT
PTTTLTEASTTTSIPTTMEAIMTTTKTTESSALISAEEEDVGLVPALLYLYKMETQRLVR
G
Download sequence
Identical sequences E9GUT6
jgi|Dappu1|248514|SNAP_00016572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]