SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|248813|SNAP_00016871 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|248813|SNAP_00016871
Domain Number 1 Region: 107-299
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-23
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 2 Region: 400-550
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-16
Family YWTD domain 0.001
Further Details:      
 
Domain Number 3 Region: 69-106
Classification Level Classification E-value
Superfamily L domain-like 0.00000000468
Family Ngr ectodomain-like 0.047
Further Details:      
 
Domain Number 4 Region: 557-579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|248813|SNAP_00016871
Domain Number - Region: 348-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|248813|SNAP_00016871
Sequence length 594
Sequence
MQVVSMEFEPDSFNGLVKLQELWIIASTRADRIDRRRHVQGQPTTSTSRLEKLSTPPLER
RRFPIVIRKLRLLNLSSNQLVQLPPGLFDSVVSLKELWLNGNKLTTDYGLVVSGISQTHG
VAADYEDGVVYWNEKSEGKAGIYKSMLDGSAFQYVVSVGVEIVEDLVIDWVGRHIYFADS
GRKHIVVCDFYAAICSVVISGQLDKSRAVAVYPEEGLLFWSDWSSSSHIGSAGMDGSQRT
NTPNSIALKVRGLMDPIVKIFPVKVTHPYALDIFENTIFWCDPLEHEVLSVNKFTGKDYK
ICESMMANFDQGSFDNSNWHPRSSSFQAKPSHQPLSKRDLQPSLSSFTNPYKCACPVGMT
LNKDGRTCESISAHESSIVIATYTDIYRMTHHQIGKDSVFRLPTRNVEYIGALAYSPLGH
SIVYSDMIQRTIYSIHLDTYRQTVLFENVDMVEGLDVDPFTENIYWTEVTRETVVVGQKK
HDGSYDRLVLARNLNSPQGVTIGSQSGRMFIVEGRISHVISVWHMDGTNRQELVKVRGIV
SAMAYDGKHLLQRLPASCIPAKYRCDGVNDCALGEDELQRRNTTTEVKYSLKTE
Download sequence
Identical sequences E9GVA3
jgi|Dappu1|248813|SNAP_00016871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]