SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|248859|SNAP_00016917 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|248859|SNAP_00016917
Domain Number 1 Region: 50-89
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000691
Family Fibrinogen C-terminal domain-like 0.0074
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|248859|SNAP_00016917
Domain Number - Region: 7-38,70-116
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000481
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|248859|SNAP_00016917
Sequence length 125
Sequence
MLLLRKYTAQEFCSASGKSLLSITNKREQNDVSTVLMPIVLNESASKASINIIPQSCKDL
LDIGHRKSGIYSVMGNKHVETVYCNFTKYPNTPDFQKWIVYEDMKSVSTCFYVQRNASFN
KKNTC
Download sequence
Identical sequences E9GVC4
jgi|Dappu1|248859|SNAP_00016917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]