SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|249169|SNAP_00017227 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|249169|SNAP_00017227
Domain Number 1 Region: 25-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|249169|SNAP_00017227
Domain Number - Region: 61-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0327
Family LDL receptor-like module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|249169|SNAP_00017227
Sequence length 189
Sequence
MPITKKTYPFKLIAIISFGCLGQLNCTAGLSVCSDLSQCIPSTYLCDGRMDCEDGSDEKW
TLCYYRKFNCADNTTAIRASLRCDAPILPSRLTTTPDPVPTLSSTFSMDEDEIAQSTIGS
VNNSIAVETEEEKDHFLAVDSLLMDEEEEVTLGFLNLFCFWLAVAIGGLAGLAFTTAVLM
QGSTYIKKR
Download sequence
Identical sequences E9GW10
jgi|Dappu1|249169|SNAP_00017227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]