SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|249314|SNAP_00017372 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|249314|SNAP_00017372
Domain Number - Region: 7-44
Classification Level Classification E-value
Superfamily HMG-box 0.0994
Family HMG-box 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|249314|SNAP_00017372
Sequence length 82
Sequence
MSNLDLLFVSGPRPRSRKKNPDCDFRSKFEPIPSQWNSVTGRSRILGETFAPTGTDFREK
KIHLFFRALKKALVKTPLVRKL
Download sequence
Identical sequences E9GWE3
jgi|Dappu1|249314|SNAP_00017372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]