SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|252189|SNAP_00020247 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|252189|SNAP_00020247
Domain Number 1 Region: 478-951
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-118
Family alpha-mannosidase, C-terminal domain 0.000000029
Further Details:      
 
Domain Number 2 Region: 39-369
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.42e-112
Family alpha-mannosidase 0.00000000329
Further Details:      
 
Domain Number 3 Region: 371-462
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.98e-27
Family alpha-mannosidase, domain 2 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|252189|SNAP_00020247
Sequence length 960
Sequence
MDRLVVASISSSLMLLVVAGLVHPSSGGITTTSRSTSCGYQSCHATKPGFINVHLVPHTH
DDVGWLKTVDQYYYGSRTGIQKAGVQYILDSVVEELQANPERRFIYVEMAFFWQWWEEQD
ESTRDVVRDLVSQGRLEFINGGWCMNDEATTHYVDIIDQMSLGLSLLNDTFGECGRPRIA
WQIDPFGHSREQAFIFSQMGYDGLFFGRLDHEDKKQRMAAKTMEMVWSSSSLGQTGWLFT
GVNYNLYQPPPGFCFDILCSDSPVIDNPKSKEYNVDQRVTEFLNYCQRQSEAYATDHILL
TMGGDFTYQDANVWYKNMDKLIKYANERQTNGSRFNLLYSTPSCYVKSLNGVKKSWPLKT
DDFFPYGSDAHSYWTGYFTSRPAFKYMVRQGSNLLQACKQMDSALSWSGSTNQGDVNVMK
RAMGIAQHHDAVSGTEKQAVVQDYQGRLHEGVVECQKTQASSQLPILGRPLADVKFCQLN
VSQCDVSETSGRFVVNIYNSLARHVDKYVRIPVAGGESYQVLDPDGKVVDSQLIPISPQV
QALPGRKSSATEELVFLAAQLPPIGSKSYYVERDSKHRRRHSFKSKSQRLVPGEDHIITT
DKVKVRVDGTTGLLSSVTVNGEEYFVQQEFLWYPGYNGDNESADRRSSGAYIFRPNGTDA
FPMRRTMTAAIITAVYTGPLVQEIHQFYDSWVSQVIRIYRGQEHVELDWVVGPVPVSDKI
GKEVISRVTTTILQSDGTFYTDSNGRQTLRRELDARESYTYTPTEPVSGNYYPINSHLFI
RDPVGEQQATVLVDRSQGGSSLIGGLIELMVHRRLLRDDSFGVDEPLDETAFQQGLQQLI
SRELPENVNLLTLENRSDGSYLIRLEHIYDVGEDKVLSLPVTVSLKDLFPGFAITSAEET
ILGGNQLKKDSQRLVWHSSSSDKQTNVRSSHSDEFPDVDLQPMEIRTFILNLVRDNRLDK
Download sequence
Identical sequences E9H262
jgi|Dappu1|252189|SNAP_00020247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]