SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|252709|SNAP_00020767 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|252709|SNAP_00020767
Domain Number 1 Region: 580-649
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000575
Family Tachycitin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|252709|SNAP_00020767
Sequence length 760
Sequence
MIRPFRFPMLSISVWTTLLLLVISFGHALNEDDQDGGPPSHRSNSSQSSGLLMNQAGRLP
ISNNNPSAFFRQQTPQQFGGLPFQQSGIGFPFNGAAGGFQQNGFPQLNSFQQSGIPQQSG
FQQSSFPLNSFSQNGFQQPAFQQSSLPQNSFLQNGFQQSSFPQNSFQQTLPQQQNGALLG
QGSQFNSLGLQNQLVGAQLGLQNQFSGNNFQNQLGIQNQLGFSQNPFGLGLLQQQNQLGL
QNQLGLSNQLGIQNQMGVQNPFLLQNQLGLQNQLKGQQQSPFSFSQQLGGSSGFSNDPQF
GFGQSSFGNFPQNNGGSQFGGAGFGTGSTSSLGSNQILLQGSQFQDSSSPSGLQFGSQTR
FPFGTSSLTNNRFPSNSQAGLGESQFGSQFTNNQFNNRDPFMSQRPQLQSSLDTRQQNRL
GRDGEFFPNERALSFNNTFDGTSQFQSLQQQQPQQQPAINPFLSQQFLGSFNNQQPFAGG
NPLPLSFNQEQLRPQQFNPFPSTLNQQQSQNQQQLGPFGTLPSFSDRPPMQFNKAPFINN
NQQDFGPNQSLMGTSGNTLSEQQQMRQPQKPQQAQSLPLPIPMTGFSCEGRPPGYYADMK
NECRTFHICIDDGSTTGLKRSFACPNGTLFDQVNSVCQWKDDMDCSRSQLFFPRPAASTT
ASIKSNSGDIRPTSSPFNTQIQSPPRNNFADSTPPTSFLHFGVGQPSPSHGSLDAGRSLD
DTRRNADISPIRSRSTLYTPPQIRPPLFRPSEQLDDRRKA
Download sequence
Identical sequences E9H3B6
jgi|Dappu1|252709|SNAP_00020767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]