SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|254089|SNAP_00022147 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|254089|SNAP_00022147
Domain Number 1 Region: 141-208
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000291
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 2 Region: 100-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|254089|SNAP_00022147
Sequence length 215
Sequence
MENLNLAKPASSARIQHTTASSAHKPDPCADLKCPPGAKCIATPDASSATCQCPTKKCYG
EARVTVHGSNPNIDDKYLTNVFLENFYANVAKCSSYGDSVGSRPICGVDGKDYANMCELH
KSSCLANRMIAVKFQGSCDPCASVECLSPSVCVMDSERKPHCRCGDTCPSDFQPVCGSDG
RSYSSQCHLQQEACRSQRHLRILYKGLCESGTYGC
Download sequence
Identical sequences E9H692
jgi|Dappu1|254089|SNAP_00022147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]