SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|254140|SNAP_00022198 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|254140|SNAP_00022198
Domain Number 1 Region: 55-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000746
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|254140|SNAP_00022198
Sequence length 119
Sequence
MAGGNEQRRNWLRMLLVTALMSSYLFLCLWSLCWSSSADATALASSSSFLAPSEVNTCDI
SEFRCPSKDGQGTLCLPMDRWCNGKDECDNRVDEPRSCTNGGGGGAPLRKIRRMHAFNS
Download sequence
Identical sequences E9H6D5
jgi|Dappu1|254140|SNAP_00022198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]