SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|254628|SNAP_00022686 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|254628|SNAP_00022686
Domain Number 1 Region: 138-190
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0041
Further Details:      
 
Domain Number 2 Region: 96-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|254628|SNAP_00022686
Sequence length 229
Sequence
MVVVLLDGVVSAFEFLRGNNLNLGAMNLNLNLPASVKESIRQTISQNVVVAVDRIFSFGS
TREGQSECVLSDSNRGLSGQMIHSPGWTYYERKVYSVNCSSNFECPSGKCINQTSVCDGL
DDCGDRSDEIVCQSQLDFQIRLAGSNKTNEGRVEVKVFGQWGAICDDHFSANDANVICRQ
LGFPLGASQALSHSTFGRVLQFCGGWQLPRILVHPSQNLVRIFRIFPES
Download sequence
Identical sequences E9H7H3
jgi|Dappu1|254628|SNAP_00022686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]