SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|257206|SNAP_00025264 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|257206|SNAP_00025264
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000892
Family C-type lectin domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|257206|SNAP_00025264
Sequence length 177
Sequence
MNHLNLDHLFCYIITFVVISSAAEPLEMAQPWNCSTGTDLCFLTPPMRLSWHEASAYCFQ
RSGGLSHSNDFKLIRSSPIWSSSTRLWIGLGWVESRLQWMTHVPHEETNITAISEETKYL
KTKSFEGQFCYTQNKDNSLKLMNCSSRLNFICVRPLTVNEEYFPKNTTLLGRNIHNK
Download sequence
Identical sequences E9HD24
jgi|Dappu1|257206|SNAP_00025264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]