SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|257231|SNAP_00025289 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|257231|SNAP_00025289
Domain Number 1 Region: 45-122
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000392
Family Hairpin loop containing domain 0.046
Further Details:      
 
Domain Number 2 Region: 187-268
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000471
Family Hairpin loop containing domain 0.035
Further Details:      
 
Domain Number 3 Region: 295-387
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000981
Family Hairpin loop containing domain 0.031
Further Details:      
 
Domain Number 4 Region: 460-535
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000706
Family Hairpin loop containing domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|257231|SNAP_00025289
Sequence length 702
Sequence
MGVGRLIAHLLFALVILIQVIGAYLTADEELVLIDEGPVCYSIIFNGRRLSHRYIERSVA
VISLDECKLLCTRETSFDCRSFNYRRRLSSTNCDLSREDSASLDVTSSRVFFSDSDVDFY
QRVGRGQSCYRPYGRPPSLSPTSSSSGSEYYYGSISNSGSLIQRPSSSVQPSITSASINE
CYRRLKSGYRLEPRIVRDSLNVRTLFECQTECHRSRIFVCRSFSYRQATNGYHSGGNNCE
LSDLDPREFDPVRHLVIDRDADIYERSLVGRNCRDTPVTTWNNRPTIKPTSTSLCFLRTK
SGIRLERRAIRHSVTVNSPVECEQECINSHSFTCRSFSYRFSSTATLSDLYHKTYENCDL
SDIDLNSLDPLRDLIDDRLYDSWQRTSYSRDCDIGSFRLPDTSGDGYINRDDEEDLHFSS
LNPWFSFGNSNQRPYPLLTSTATAPSRCYISYRLGFRMVKRLIRESIHVRNLAECELECS
RTRPFTCQAFHFRYTNLDGGYDRNPYNCELSDLSARDFDRYRDMVEDRDYELFTRSQFSS
CIQSFNNLESGSQLSPILAISSSEVTVSGIRCRAGAKCRPHRELGYWYCEIDQTSYYKFN
NNWDYCCQPQSRCGYSDGYTYPWCMVGSEASGQWRPCSDRYAERPYAYLHRHLPPNATEP
TGVSPPLKSDDDVIRPIDSNSADYLRTGSHFIVTTNCTDADK
Download sequence
Identical sequences E9HD48
jgi|Dappu1|257231|SNAP_00025289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]