SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|258663|SNAP_00026721 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|258663|SNAP_00026721
Domain Number 1 Region: 80-122
Classification Level Classification E-value
Superfamily HMG-box 0.00000000851
Family HMG-box 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|258663|SNAP_00026721
Sequence length 125
Sequence
MDTCSYQHPSDAELASVIKMKMSLPVISSAAGSSSLHHHHSSSSSSRATSIMQLAQQHLP
KSDIGNAVAKVLQGYDWSLVPLASSRSNPEKRDTHVKRPMNAFMVWAQEARRQLADQYPQ
CTTPS
Download sequence
Identical sequences E9HFU1
jgi|Dappu1|258663|SNAP_00026721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]