SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|259451|SNAP_00027509 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|259451|SNAP_00027509
Domain Number 1 Region: 12-103
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000056
Family C-type lectin domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|259451|SNAP_00027509
Sequence length 111
Sequence
MPCWTLGGKCDCFFTETVGKDWISADTFCKDEGMALLSLEIVEEDKLIYDHIKITPELNS
VSYWTVGMYSLDGDKIWEWASTEPFQPFTCVNWSPGQPDNNGPGFRQAHSM
Download sequence
Identical sequences E9HH90
jgi|Dappu1|259451|SNAP_00027509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]