SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|259784|SNAP_00027842 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|259784|SNAP_00027842
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily HMG-box 0.00656
Family HMG-box 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|259784|SNAP_00027842
Sequence length 137
Sequence
MAKSLEQRWIKLSEVEKEPYRHLMEKRNQDIEEEIQILDKIIIAKRPGSRSYAGDQLSVQ
IPQKDKAIENKMYKCDQFRQSGQRLHKTQLARQHYGTANDRRQGMANFIRSKKRSTVGDE
VVDHILFKSLLYGSVDF
Download sequence
Identical sequences E9HHV5
jgi|Dappu1|259784|SNAP_00027842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]