SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|260755|SNAP_00028813 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|260755|SNAP_00028813
Domain Number 1 Region: 37-157
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000262
Family C-type lectin domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|260755|SNAP_00028813
Sequence length 252
Sequence
MDDNEDIEYADDETEEYVEMPEEPEYYIHDEREKCVWGLWIVFLLTMVGVVIGMTLYINQ
VYFLIKDPEPTFSTTEILDGYRHDFFHEPRTFNDTQRICFNRNSEMIVFNNTEEHSRFNQ
YVADYFQPYIRNHTDRWKRVGLQIWTGIRIIFKAGQLTQFDWPGRTESPEEMLNFYYISQ
HNRLCNIGTIERMQQIRKAMQSKYASRQFIVKDFTTKAENAINEIGCWQVRFLEENESLI
LPFVCKSRIIPT
Download sequence
Identical sequences E9HJU1
jgi|Dappu1|260755|SNAP_00028813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]