SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|260992|SNAP_00029050 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|260992|SNAP_00029050
Domain Number 1 Region: 234-297
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000962
Family C-type lectin domain 0.012
Further Details:      
 
Domain Number 2 Region: 101-189
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000245
Family C-type lectin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|260992|SNAP_00029050
Sequence length 316
Sequence
MPMKILLTVVNLIAVQNTLNPLLDMDDPLEVKKDVIFQDRLIERLSSLVQSTEQNILTML
SEMQNPPFVQLLKGICPKMLMQEPSNDGLKFRCHASGINECLCFSHKKATWYKAEAFCRQ
FRMTLADVPTDKVEWIKHKVNNPSAVDGKGEWYWTSATDRFARGQMIWMNTGQLYQNPNS
NSDATSLCVIVGPITPVSAESTSFLQEIESLEDEYFALIETISKEDDINDILIHGTCPKH
FTAKKFRCLKINGECYCIVSEDKNWWSALHYCRQYGMELLSLETKEEENNLAKQLKAEKT
NGDHGNALYKLKNNYT
Download sequence
Identical sequences E9HKB4
jgi|Dappu1|260992|SNAP_00029050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]