SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|261018|SNAP_00029076 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|261018|SNAP_00029076
Domain Number 1 Region: 94-160
Classification Level Classification E-value
Superfamily SRCR-like 0.00000112
Family Scavenger receptor cysteine-rich (SRCR) domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|261018|SNAP_00029076
Sequence length 185
Sequence
MIILSIDRWRYDYVYFKYLSAHESQIEQYDNNTGEEDNDLAKQSSFHLSFQTQPTEDGPM
IVPWINHVGIPHNSPPTLPICYNQSPNQKAGVVRLAHVICRQLGFMTVTKWFGISKEAVG
LHLNSTGLSAYCRGDEQFVDHCQWQRPIVPSCSHFLAIECGDCSRSYLMTEETRITLASP
GFPEI
Download sequence
Identical sequences E9HKD4
jgi|Dappu1|261018|SNAP_00029076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]