SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|262610|SNAP_00030668 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|262610|SNAP_00030668
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000021
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|262610|SNAP_00030668
Sequence length 83
Sequence
MTKDIYWTSGRYSQEGNKRWEWATTQPYQPLSYTNWNPTIPVQPDFNKPGYCSDISFFQT
GHWFDDLCSSNIKFICESKLRPR
Download sequence
Identical sequences E9HNA6
jgi|Dappu1|262610|SNAP_00030668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]