SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|263056|SNAP_00031114 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|263056|SNAP_00031114
Domain Number - Region: 39-103
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Hairpin loop containing domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|263056|SNAP_00031114
Sequence length 123
Sequence
MSAAQCNKIFLISAVLVMVAAILPAEAIRTWDDWHNGDDGVKWMYNCEFPGAWTLEAKAF
NSDYSPMEESKCGRACIDRRGCNSFVFREGTCFLKSSSIPGSYKPYRLCNQCDSCGFLPW
KFH
Download sequence
Identical sequences E9HP07
jgi|Dappu1|263056|SNAP_00031114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]