SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|263601|SNAP_00031659 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|263601|SNAP_00031659
Domain Number 1 Region: 82-337
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-42
Family YWTD domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 389-634
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-30
Family YWTD domain 0.001
Further Details:      
 
Domain Number 3 Region: 822-1047
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-20
Family YWTD domain 0.00061
Further Details:      
 
Domain Number 4 Region: 750-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 5 Region: 677-711
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 46-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 7 Region: 719-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000206
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|263601|SNAP_00031659
Domain Number - Region: 1100-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000262
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 345-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00203
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|263601|SNAP_00031659
Sequence length 1422
Sequence
MWSVLKLISAHSRCKGIRWIARVNTVWETTECSKLSDAPMVATFSKTPRIQCGNGDGCFE
LEQRCDDVKDCEDGFDEDECEPLLLITTDSDIRSMPIDSEEYKFIQSDLSQAHGVSVDYK
EQSLYWSEKSDGKSGIYKSSLDGSRNQKVISVGVEEVGDLMVDGPGRHLYFVDSGRKTIV
ACDLQGTICVVVCGQLDKPRALAVYPEKRLLFWSDWGSHPHIASAGMDGSKRTHIITTDV
AQPSGLAVDEATGRIFWGDVQLSRIESSHIDGSDRKVLQKEVNPFALALFRNLVFWCDPT
EHEIISVDKNTGGQFKVMIRDDALILTSIQVHHPSKQRFTQNPCQNASCSHLCLLSPSVE
GFHCACPAAMTLNIDNRTCDFTTVDDTSIIVATKTDIYRLNNNNQNEKNSIVHLSKNLHL
KNVGALVFNPSDNSIIYSDSVDGVIYSMDLNSRHEVVLFENADVVEGLDVDPSTESIYWT
ERSRGTIVKFAIGRKHLNGVREQLVLARQLKNPRAIAIAPELNLMFVVEGSESYVITVWE
TDGNWLNNLVQVHGTVTSMVYDDKHLYFTDSLRGTIERIEVGGANRTVLQEHLKTPIAIS
LTLDSVFWLSGHSRINWLNKQDPETKHEFSIGTTSPKNVEQYRLMVVVNDLKLSRHGSTG
DCITANGSDCHYKWGSSCSEGDFRCDNGHCIPMDSVCDEVLDCPDGTDEGDNCDTPCEEN
FCEHNCVPGPKGPICYCEAGYRSENNGPQCVDIDECLSENRCSQYCANTEGDYDCSCVPG
YYLEPDKYTCKVMDGRPLLIAASAHRVALLRNNNVTASHRGLASQDAPIKGIAYHGKFCT
LFWITSAGVSRMRDVGQAFAYKLEGLTPTGLALDSITGNIYVSALVANQDRSVVKVVSHS
LDADVDIVNSQAKITDIIIDGVRGALFWSEHLRSASGRIIRSTMDGKVTREIYYSGAAYP
VALALDTVKTRIYWADKGQSISSCDYDGQQKKKLVVGRTNGQPLSLTFFENRISWTVWRR
NVVYSQSVTGEPATSSLKPLEDVHHLFTSHSILEPEYPNPCKSSSCGNGLCVLRNSSSFS
CFCPTKTNVVSIAPFECSSRCPSHSFYCQPESECLPLSLVCSDHQDCDKLSDQDLCKSAN
KTISSEDIFSTDILTRGRLQYLFEFPLILSNVSARGIADAAKQNGQRTSFRSASERKVLY
SRQIEIRDEIFVNDGLSGEGSSYPIEMALQAVLDGPVHVLSRLFTKKGHHIDHATVFNQD
KKPVFINSVWDSKNHTTPRFVEDVEVSFGNQLMLWKVFRPQAYTADDHLNLRTVHQMELR
TLQKMGFHLQLWYYRRTTSFTEQGGIGLSSACRLKQNKSKADDSPTSTEISIGYPMDVRA
DPVGCPSWTSYGCLKDILMSSPVDVQLGISMDVQKTDVFGIS
Download sequence
Identical sequences E9HQ28
jgi|Dappu1|263601|SNAP_00031659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]