SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|264276|SNAP_00032334 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|264276|SNAP_00032334
Domain Number 1 Region: 143-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000524
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|264276|SNAP_00032334
Sequence length 212
Sequence
MDWKVFVLVAILPSALSLPMELCCQSSSSSSSLSSSLNVTLDSSIPVSDSEMLEPFISPS
ISSSKTPDPVLMLMPQQEPPSCCGNDNDLPTEKKQVKRTRMKIRGTTSSGLRRTKRFPIH
LDPLYQYRYLARSGQCPTAKDGQPEFYCPTPDRNGNWRCIDDFQLCDGVRHCPNGEDELP
VSCLFYRVVETHLLSVSQRLNSDENRQRGVPR
Download sequence
Identical sequences E9HR92
jgi|Dappu1|264276|SNAP_00032334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]