SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|264543|SNAP_00032601 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|264543|SNAP_00032601
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000112
Family C-type lectin domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|264543|SNAP_00032601
Sequence length 156
Sequence
MTILAIETPEEDKLIYDHFQKYHVNTTIRLLANTLKTNQRWEWISEWRDGISYENETSTI
APPAPGQPMTYTNWYPGQPSNVEDGNRCLGLMFNYGIPFEGGYWDDIDCDYMSGDVQGHG
RPTCEMPLSSATPRLRFLPVCSAGPQAIDRSIGTYL
Download sequence
Identical sequences E9HRT6
jgi|Dappu1|264543|SNAP_00032601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]