SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|264932|SNAP_00032990 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|264932|SNAP_00032990
Domain Number 1 Region: 54-96
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000589
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|264932|SNAP_00032990
Sequence length 113
Sequence
MAPKSFQIRWFFWMLVAGVAWVSSAEENQVRQYNYGDNGQTIWMWNCDWINNDIAQKPSS
ADQCGGVCIAYPNCNHFTWTNGVCYMKRAKLPTETRRVNGICGWVLSRAHWSS
Download sequence
Identical sequences E9HSK6
jgi|Dappu1|264932|SNAP_00032990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]