SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|267420|SNAP_00035478 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|267420|SNAP_00035478
Domain Number 1 Region: 46-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000628
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|267420|SNAP_00035478
Sequence length 141
Sequence
MVEAPTVRFNSISELFTLKRMITIQPKPAFTFEDDFHWGQLHRRGKDNRCIPLYWRCDGE
KDRQDGTDDSSSYLKLSRHINQSQAIVTKEPDIHFMEDETVEGVSLVRDFQQVRQMQVLL
GKFAGARGFEHTFFPALWATP
Download sequence
Identical sequences E9HUW9
jgi|Dappu1|266349|SNAP_00034407 jgi|Dappu1|267420|SNAP_00035478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]