SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|267643|SNAP_00035701 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|267643|SNAP_00035701
Domain Number 1 Region: 102-227
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000144
Family YWTD domain 0.0044
Further Details:      
 
Domain Number 2 Region: 659-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000547
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 3 Region: 587-622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 349-385
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 631-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.068
Further Details:      
 
Domain Number 6 Region: 389-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 2-76
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 0.0000769
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|267643|SNAP_00035701
Domain Number - Region: 431-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000122
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number - Region: 311-344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00302
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number - Region: 550-571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0072
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number - Region: 267-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|267643|SNAP_00035701
Sequence length 747
Sequence
MYKLYGYKFFSSATDADTALTLARVVDPATDKITSGSKGFLLFLVYMDQPSNLHLMRLKQ
KLGTKLDALGYLSADDPIRKRRHGRGIGLTRGTVVIGQKNHDGVYERLVLARDLYSPQGI
TIGSQSGRMFIVEGRISHVISVWHMDGTNRQELVQVYGTVSAMTCDGKHFYFSDSLRGTI
ERIEVNGENRTILRFHLGTPVAMDASSDSVFWLTQSSTRISWLNKQETKTMRGFVIDASD
DINVQYRLMSVIDLFDFNSHDHHFFHHTGGCSDICAPTPDGPDGVACLCPLGKVLGEDKH
VCTKADCVGDEWFKCRASCIPAKFRCDGVNDCARLGEDELQCRNTTTEVGCTSSQFQCIN
GGCVSIHYNCDGDADCRDRSDEPDSCPPYVCKGEGEYSCPNPHHCIPRSAVCDGQADCID
KLNEANCSSTHSMCSSTQFYCSHSHIYIPLTWVRDRDSDWQHGEDEDSSVCDSVVNKPPC
PINYLRCPQRPDCMPRIECEHGTDADLCAKLNDSFIETETEKPDCLSSQYNCFLGSNECI
PITSRCDCRIYISWVCDGLSDCSNSADEALLLCPANVSTSSSSTTKITRSCSATDFMCLS
GECVQASSVCDGKFDCFDGTDEGSGCAKACQNNGQCPQICVPGPMEPTCLCEPGYESLNN
GKQCVDIDECAFEFNKCSQFCNNTKGGYRCSCASGYSLEPDQITCKAASGRPMLIVATNH
PVEILLNSDITSSRFLVQSVPAIKGIA
Download sequence
Identical sequences E9HWR7
jgi|Dappu1|267643|SNAP_00035701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]