SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|268331|SNAP_00036389 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|268331|SNAP_00036389
Domain Number 1 Region: 393-926
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.59e-155
Family Myeloperoxidase-like 0.0000000882
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|268331|SNAP_00036389
Domain Number - Region: 918-954
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Pan module (APPLE domain) 0.031
Further Details:      
 
Domain Number - Region: 33-59
Classification Level Classification E-value
Superfamily LysM domain 0.00602
Family LysM domain 0.0094
Further Details:      
 
Domain Number - Region: 199-228
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0883
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|268331|SNAP_00036389
Sequence length 975
Sequence
MGSYAVAIPYLPITSVVCLFLMSFDAGRNCLPIKRWDTCWEIAISCGIDLDALCKINPSL
IGGQACDNLRIVDAIGCQAARNAIEENWNTGDGNVKWQFNCDYYGHDLERLPSSGENCGG
LCVAHPKCTHFRYTDDGYCYLKTLPLTSRRTPAKGGVCGYLPFKFESPPRDVWNSGEGGV
KWLLNCDFFGNDIGRIEATGEQCGGLCVANPECNHFRHSDGTCYLKKTSLNTPRTPINGG
VRWRIRVEMPAGYGAPPLQENEKKAKQYNLVFNSPKQQQQYNSINNSMNSAADAGKLQMK
VTDTIETQLFVKKIFVLPGSSRATHALLFTSTAESEKMSRDAMMESYTVTEIVKRFNIKP
EDVQRTMKQFNLKDTILSGMCTADPVCDEKTIRSPYRTLDGSCNNIQRPSWGKSLTQFQR
ALPSAYADGVRTPRRAKNGGELPSARLVSTTVAVDIDSPSQSDTTWVMQYGQFIDHDFTR
TPEFKMGTTSKFQSEEPMEALFRAVCRMGNLLRKSLSIPSVFRLRFRRTILFFSKFGQRC
MPLVRSAPIRRSDCTFGASEQMNQLTHFLDNSNVYGSDDKTARELRTFKKGGMKVTPRNE
LDLLPADEESKVSCTLSKTVSGIDPPTDVKCFKTGDTSRVNEHPNLAVTHTIFLREHNRL
AAELARLNPGWDDERLYQEARRILAAQMQHITFNEWLPVIIGRVKMQELGLLPLQQGSSQ
DYDKNLNPSVLNEFAAAAFRFGHTLIQGKHQYEIYTPGNLDKFLIGLASQPSQNAENYFT
QEVTNHLFEEQGKGFGLDLVSLNLQRGRDHGIPGYNAYRTQCGLPPAGQFSDLLNLISPA
IVDKFAKLYDTVDDIDLFIGAMSERLAPGALVGPTLQCIISDQFLKLKRGDRFFYDLAGQ
PSSFTKDQLTEIRRASFARLVCDNSNCGRLCIDDGKCNAFTYNSATGICFLKDIPASYGR
SPWNGAICGFLPWKF
Download sequence
Identical sequences E9HXN3
jgi|Dappu1|268331|SNAP_00036389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]