SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|269364|SNAP_00037422 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|269364|SNAP_00037422
Domain Number 1 Region: 124-196
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000286
Family Endostatin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|269364|SNAP_00037422
Sequence length 231
Sequence
MKNGKELSANSVPPGGDSANFAELVVRFGKINKKSNSAKTNSANVKFAESSNAAQSSATI
CPVPEMKKVFGDWSIEDQERLPSIFKIGVDGDFTKLVAQFPNQTVDSNEFLSATNGQYVD
GTLPSGAGPSGERQLDSYCDAWTSSDDKTLGVATSLIASSPSSHQQQQQTSGGGGGKLLA
QDKLSCQNRFVVLCIEATSQGVATGGSGRVKRTAEHIISEDHYQAHLQSLF
Download sequence
Identical sequences E9HZ77
jgi|Dappu1|269364|SNAP_00037422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]