SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|269751|SNAP_00037809 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|269751|SNAP_00037809
Domain Number 1 Region: 45-218
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000114
Family NodB-like polysaccharide deacetylase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|269751|SNAP_00037809
Sequence length 221
Sequence
MQRILAVIFFLVVFLQHQSQAQCNSTNCVEPACKCMNTSPPGAQLVFLAFDGAITVTNYS
NYTFLLNNIINPNGCPSGMTFFVYHEYNDYTLTHSLYFKRNEISTHSMSHSTPSSDWAYK
SVSEWTDEIGGIQEALAKFANIPKAEIWGARAPFLQSSGDDTFTAMKNLGMYYDCSFPTT
ENTNPPIWPYTLDQGFQHECTIPPCPKDKYPGIWTVPMMAV
Download sequence
Identical sequences E9HZQ5
jgi|Dappu1|269751|SNAP_00037809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]