SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|271320|SNAP_00039378 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|271320|SNAP_00039378
Domain Number - Region: 54-94
Classification Level Classification E-value
Superfamily HMG-box 0.0474
Family HMG-box 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|271320|SNAP_00039378
Sequence length 129
Sequence
MGTEEAKFNLQKKLEEFIDIAEKQEMFGAATNIAAGSKGLQLIDAIRAVEVKFGSKLSAA
CHIAKHPTDPISDYLVFANKVIRDQKGDNPSISQKGDANIVVFSNPTGRAIVREKNNEVL
LMTYYPFHY
Download sequence
Identical sequences E9I1Z7
jgi|Dappu1|271320|SNAP_00039378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]