SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|271340|SNAP_00039398 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|271340|SNAP_00039398
Domain Number 1 Region: 59-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|271340|SNAP_00039398
Sequence length 244
Sequence
MANNSCNNSSGLWRLHMGTNGCSSRSTPKPRPPPPLPSPTPAVRPNITFQTYACPPAYAT
YYCLNGATCFTIKIGESILYNCECTEGFMGQRCEYKDLDGSYLPLREKIMLERASIAGGA
TVAVVLVVIISIIFYTYVRQQRKEQRLASFEQVTVDRIQIRSRSCSSCNSFGGCRFGVAS
TKNDCLLHQQRPHQFTLSSGYKKVKHPNLISIDYAHALRLTGLACDPVSNTNAPINILVR
SINL
Download sequence
Identical sequences E9I206
jgi|Dappu1|271340|SNAP_00039398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]