SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|277937|SNAP_00045995 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|277937|SNAP_00045995
Domain Number 1 Region: 133-182
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000713
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|277937|SNAP_00045995
Sequence length 185
Sequence
MAVTFLRTLGLAVLSTALAGCLVNRADLASDGGAPVSPDASSTIDAPGLDAPLPPDLDAA
RREEDAFVVEGTDAWVPTPLDAWTAPPPDAWSPPVCVPTGAELCNAHDDDCDGSVDEAAC
GIVHSVGVVSCEGFVHGTHVYQVCKASSPVPWDGAVMACDLFPYDLVRIDDEAENAAISA
HVPDA
Download sequence
Identical sequences E9I6M6
jgi|Dappu1|277937|SNAP_00045995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]