SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|279127|SNAP_00047185 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|279127|SNAP_00047185
Domain Number 1 Region: 94-189
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000871
Family Sulfatase-modifying factor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|279127|SNAP_00047185
Sequence length 190
Sequence
MHYSLFQKEVGSTLSEKQFVGHAVSQIPPPILTAQEVLALVRKRLVNLIELESLSEHWGE
REGLPVPERARAGVVLSQLVDPRPGVGVAANGLPDIDWVELPPGRFKFGANRKEAVIPAS
FKISRYPTTIRQFRAFVDASGYKLAEFWKDAAAAGVWRDGKVKESGAHDWRDCPVDHGPE
FGVDNHPIVG
Download sequence
Identical sequences E9I781
jgi|Dappu1|279127|SNAP_00047185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]