SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|290667|MRW_gw1.77.131.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|290667|MRW_gw1.77.131.1
Domain Number 1 Region: 109-364
Classification Level Classification E-value
Superfamily L domain-like 7.31e-44
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 376-668
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.24e-41
Family Rhodopsin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 20-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|290667|MRW_gw1.77.131.1
Sequence length 764
Sequence
MFCSLIIAHLLNLPKKKDGPCGSGSFQCGNSSVCIPQQSYCDNDPDCPNGEDEEYDKCGT
LAHSGSFSQSRSHLNNEASHYIDDKEKEKGQPTTHSNESSPLPLSLCVLCIIQHMGLANI
PEQITPPNTLSRLILANNSIKTIPRFAFSRYTVLEIIHLEQNSIRTIANDVFRHQKLLRF
LYLSKNSINGIEPNGFKGLGNVTRLFLDNNEINDTSLDALNSLPNLQWLDLSSNYLRLSN
HSFSSWIHLRELMLEHNGIQYIEEMTFRNLSSLTYLDLSHNLLTTIPPRLFAQNIQLTSL
SLGFNNILQLPAEVFLPLKNIKSLNLEDIDIQNIDVDMFSSLTNLDFVYFIRFQYCSYVP
TVPKCRPNTDGLSSTENLLNRTLIRIILWAIAIFTLIGNSLVLLGRGILKDENKVPLNFI
RSLAVADMLMGFYLFAIAIQDLQYREVYRQYSHQWTSSLGCTFVGVVAMTSTEVSLLLLA
FMSMERFLCIASPFGYTKLNQKTAKISLVLIWGLGLIMAIVPVLYWRQSTHYYGSNGLCF
PLHIGESLSLGWQYSAFIFLGVNSLCVLVVICTYVGLFVSIRRTRGQTPLANPNDMDFVL
RFFFIVLTNIMCWAPVYVLRLLVLLKYPVPDEVSIWVVVFVVPINAAIDPILYTFTTPKF
RRLLAQLFAATGAGSANNSRRFNSTSIKLKADQSYLQPMLSPHHRRMSWDQHLHLTRRIS
RDTSHATTVVAADPVALMDGIHDPSVLIEMVSLQSPMAGRRNSL
Download sequence
Identical sequences E9H6X8
jgi|Dappu1|290667|MRW_gw1.77.131.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]