SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|299684|SMI_jgi|JGI_CBTP1704.rev| from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|299684|SMI_jgi|JGI_CBTP1704.rev|
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.49e-32
Family Complement components 0.0011
Further Details:      
 
Domain Number 2 Region: 251-311
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000824
Family Alpha-macroglobulin receptor domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|299684|SMI_jgi|JGI_CBTP1704.rev|
Sequence length 329
Sequence
MLKFHQGGLAENEENLAPLTAFTLISLLEMYTEDAGKSAERKKTASLVNKLLKNTLPCLE
PDETEMDDVYTRALTAYALALAGQSDASRQHIDWLMARAQSNNSLLWWQKPESGPALNVE
MTSYVLLSLVKLGSNQDLLKARSIVRWLSKQRNSEGGFVSTQDTVVALQAIAAYASLIGT
QTVDMEILVTAGEFENYARIREHDRLVQRRIDLPSPLATEVHIDTVGDGSGCAVLQATLR
YNVRTPPPSAAFHLNVSNVPVENDAGQKNKCQQQVVVCSRYLGSKHEESNMALIEIGFVS
GYEVDKASLNVRNFRRLGIFVLYLLKNIY
Download sequence
Identical sequences E9HDC5
jgi|Dappu1|299684|SMI_jgi|JGI_CBTP1704.rev|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]