SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|30003|gw1.40.215.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|30003|gw1.40.215.1
Domain Number 1 Region: 1299-1499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-33
Family Pentraxin (pentaxin) 0.0018
Further Details:      
 
Domain Number 2 Region: 1563-1632
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.34e-18
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 2312-2381
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 3254-3315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.03e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 2195-2265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 3137-3207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 2255-2323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-16
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 8 Region: 2573-2642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 9 Region: 1621-1695
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 10 Region: 5-82
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000193
Family Integrin A (or I) domain 0.0056
Further Details:      
 
Domain Number 11 Region: 2434-2504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 3197-3259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 264-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000848
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 14 Region: 2005-2069
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 2696-2766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 16 Region: 1755-1826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000243
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2133-2206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000688
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 1167-1291
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000847
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 19 Region: 2880-2952
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 20 Region: 2633-2703
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 204-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 2370-2445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000085
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 2060-2144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 24 Region: 2824-2878
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 25 Region: 1067-1184
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 26 Region: 1937-2007
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000584
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 2756-2826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 1877-1947
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000876
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 29 Region: 853-1014
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000534
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 30 Region: 1819-1888
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000681
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 31 Region: 1684-1758
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000987
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 3090-3148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 33 Region: 2975-3019
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 34 Region: 1510-1574
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 35 Region: 2528-2584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000418
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 36 Region: 319-378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000139
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 37 Region: 3011-3071
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000751
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 38 Region: 99-252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000341
Family Growth factor receptor domain 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|30003|gw1.40.215.1
Domain Number - Region: 553-615
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000208
Family Complement control module/SCR domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|30003|gw1.40.215.1
Sequence length 3316
Sequence
VLEEARSEAVKAVFLITDGYSNGGDPRPAAKRLREQGVRIFTFGIRNGNVKELYDMASEP
AQEHSYIVDSFEEFEALARRALHEDLQTGSYLPQRNRSACDRLCRDQSECCHPSAECTCG
THTGHYACLCPPGHYGTGLKDDCHPCPGGTYRSDGGPGDLRSCRPCPDENHISPPGSTSE
SQCQCPRGYVPSEEDGGRTCQLLACPKLDPPANGYFVKQTCNSVFNGACGIRCNGGYKLI
GSSIRLCQENGTWSGEEAACQMRSCGSVPPPKNGKIECTSDSYVIDSECTFSCDVGFTLV
GSRKRVCLPIGYWDGLPAFCKPVFCNPLPKVMNGTWGPSKCPQAKIRYGEHCNATCATGF
ELRGPAVRRCSELGAWTEEEIKTRCVDVTPPEITCPADVTLDAEAGENFASYSWDHPLVS
DNSGAVPDVISVPAVTEQPMRFRIGNATVAYKALDRRGNQAECSFQVTVLDGQPPTVDQC
ESPPTFLLRDRNASVVWDEPVFSDNSGRPTTVERSHDPGRFPLGETEVVYTATDESGNSK
TCTIVIRVQEHACHLPIDPIHGQANCSQQPDAVYCSLTCHDGYAFAMPPPRNYFCAYDGQ
WLPADSPLPFPDCSVTTHSDALIQDGLLRLTNVGQGSEEEKICQDPFLMSQMEGHFKRRL
AARLNEICGDNMICQVDDLQAECRQVVAESDDDPSMLEEEDGQNSVDWEETNEITRSRRS
VTAGRYHRHSVDWSKIIRRMKRNASSNSTKSNADKSKKNSGLTLELRFKISTTTTSRTTT
PTFSRLTPEVMLNELNQLRALLTESALSGEFNVNYTAGQLLNVFDVQFQGDVERPKFSCP
AGSVPIKANDNNHNNNNNATTSNHDFARCVYCPIGTFFNVVNEVCESCSQGSYQPEEGQL
SCLVCPHNTSTKVVNAKRSDDCQAQCLAGSYSPTGLEPCSTCPQGTYQTEYSQRNCLPCP
SGSTTWRRGARRLDDCKSVCPRGLVSETGLAPCFSCPVGFYQPLNGQRFCIRCPRRSPYT
AGIGAVNRMECLRTRPITDENYVNGTDEFPEPEATEEFEEMTLLEVNECFSLPCQNGGQC
RTLDFGYVCDCPAGYTGMQCQTDVDDCASLPCLNGATCVDAVNSYQCLCPAGFSGAQCQT
DIDECLSGPCHQGATCLDKILGYVCVCPPGMAGSRCELEVDECLSGPCQNGGTCYDRVAN
YTCVCQPGWAGKLCEQAVDECQSQPCLNGATCEDLVGNFICHCPLGYDGPLCQNDVDECL
PEPCAAGSTCVNRLGSFACLCPPGVVGSTCDTAVNSDFSLEFTSAGKLDYAVWEGGLRTD
ARPLRQMTMCAWIKTTDQQNYGTVFSYATDDEANSLTLTDYSGFVLYVNGAKVVTDVTAN
DGRWHLICATWNSPDGQWRIYSDGELKDKGFGLASNSSIHPNGTVILGQEQDVRAGGFSN
AESFVGQLYGVELWDSVLDDQQIAALTLSCHQPDSESSSQYRGNLITWADFKHGLRGGIR
VEESIFCRGCSDPIPPQHGGVKVEGNEAVYECELGYLLSTPSPRRPCLVYGGWSGPDPEC
QRVSCGFPGYILNGLVNGTNFVYGNTVSYNCTRGFRLSGDGLRTCEENGQWSGYPPECVP
VTCEPPIPPVNGSQIEPPVSQEFYAVGDRITFQCSTGFRLDGPYSLTCQDEGQWDDVLPV
CQPLACTRPPYVEHGIVTNGVAEILPEDLPHFLVPGSILTFTCLFGYQLESSAEVQCSHE
GFWIGQIPKCVPIQCGTPPEIDHATVQLSRPDNDRVGSVASYVCQSGFEHFGPAELECTE
SGTWLDRNKQATLPVCMPVDCGSPPTVDNGGVYAEEQTFGSKAPVTCYSGFKLMGASSWI
ECGADNRWGVAPQCLPVACAEAPLVRNGTQSAAEPNFGSKALFRCDQGFVLSGSQQRTCG
SEGEWIGGAKPKCVPRTCSMPDIIEHGYIGFEVGGSATSLGTGSVILYDCEEGYKLVGAR
ERSCLPSGDWTDQEPSCHQIFCERLPSTMEHGTVTGAEENIYGSVVQFVCHPGYELDGPE
RLSCEDDENWSGIMPTCRPVECPNPGLVANIVVSLKQADVRLDPEVYHYGDILVYTCRRG
YGIVKSDNDSGVVERRCLADGSWSSKPPVCSRVSCPPAVIPQNGYTSRPSSYGFGETIQF
SCRLGYVLEDPQMSALTCADDGQWDEQKIPVCQPIRCPDVQVPKHGTVSGTSSILDSRIT
FSCQEGYQLNGEEQITCRPDGTWSHPVMPVCVTRSCGDPPNIDNGFAVVRGTGVGDTISY
SCQTGHRLSGVESRTCLSNGRWSGEDPACDPVVCAVPEAPEHGSWTVGGFVPGSTIRFEC
KPGFTLVGSATVTCLTDKSWSDRPPSCQQITCPPLRDPEHGTVQQPLKSSYGFGETIQFS
CRLGYVLEDPQMSALTCADDGQWDEEKIPACKPIRCSVVQLPKRGTVSGTSSILDSRITF
SCQEGYQLNGEEQITCRLDGTWSHPVMPVCVTRSCGDPPNIDNGFAVKVYDQAPEEDIKI
NEEQPLKSSYGFGETIQFSCRLGYVLEDPQMSALICADDGQWDEEKIPVCKPIRCSDVQV
PKRGTVSGTSSILDSRITFSCQEEYQLNGEEQITCRPDGTWSHSMPVCVTRSCGDPPNID
NGFAIEPPVSQEFYAVGDRITFQCSTGFRLDGPYSLTCQDEGQWDDVLPPFRCQEVVCSE
PETPANGSVTFTSSNFGSKALFRCDQGFVLSGSQQRTCGSEGEWIGGAKPKCVPRTCSMP
DIIEHGYIGFEVGGSATSLGTGSVILYDCEEGYKLVGARERSCLPSGDWTDQEPSCHQIF
CERLPSTMEHGTVTGAEENIYGSVVQFVCHPGYELDGPERLSCEDDENWSGIMPTCRPLI
RCPQPPVVKNGKLDGNGKKEYSYLDSVKYECDFGFRMTGEDRVACTFSGDWEDQIPTCVR
AICLSVDILEDGIITPVYPPSDGQKAGRQQRPMALKFSCQDGYDLVGSALTECTSTGEWN
HPFPACVPWPCESPPIPPNSQIQSTVIRPDIITAIVRCDPGFRLLGSNLTCGPAGIWKGK
AECEAQLCPLPKQLSTGKAVIGDFKFTQPLKSSYGFGETIQFSCRLGYVLEDPQMSALTC
ADDGQWDEQKIPVCQPIRCPDVQVPKHGTVSGTSSILDSRITFSCQEGYQLNGEEQITCR
PDGTWSHPVMPVCVTRSCGDPPNIDNGFAVVRGTGVGDTISYSCQTGHRLSGVESRTCLS
NGRWSGEDPACDPVVCAVPEAPEHGSWTVGGFVPGSTIRFECKPGFTLVGSATVTCLTDK
SWSDRPPSCQQITCPP
Download sequence
Identical sequences E9GSD4
jgi|Dappu1|30003|gw1.40.215.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]