SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|300823|PASA_GEN_1100127 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|300823|PASA_GEN_1100127
Domain Number 1 Region: 819-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000012
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 2 Region: 333-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 771-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 1080-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 925-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000725
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 6 Region: 270-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 7 Region: 974-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0016
Further Details:      
 
Domain Number 8 Region: 507-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 9 Region: 865-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 10 Region: 456-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 1026-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number 12 Region: 396-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1129-1177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|300823|PASA_GEN_1100127
Domain Number - Region: 1582-1760
Classification Level Classification E-value
Superfamily Tropomyosin 0.00634
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|300823|PASA_GEN_1100127
Sequence length 1776
Sequence
MDSKFSLLVLIVVVATCLTTGVVSQRPHPCEQSSCYPATGNLLLGREMRLSSSSTCGLQK
KEKYCIVSHLEDKKKCFWCDSRPEQVNSPSSHHIQNILYRYTPTSRRRSWWQAQNGVENV
SIQLDLEAEFHFTHLIMTFKTFRPAALLIERSYDFGRTWKIYRYFAYNCAESFPGVSREP
PRNLTEVICESRYSGVAPSTEGEVIFRVLPPNLPIDDPYSQEVQNLLKMTNLRVNFTKLH
TLGDDLLDNREEIQDKYYYAIYDMVVRGSCSCYGHASRCLPLPGVDERTDMVHGRCECTH
NTKGLNCEQCEDFYHDLPWRPAIGRQTNACKRCNCNQHSDQCHFDPAVYEATGRISGGVC
DDCNHNTMGRNCEQCKAFFYQDPTKAISDADVCLPCDCDPRGSLDDGICDARSDPSGGVQ
AGQCHCKRFVEGRRCDQCQHGYWNFTEENPDGCQVCSCNLLGTYENQGCNVYSGECVCKR
YVTGRDCDQCLPEHWGLSEARDGCKACECDPGGSYDNNCDLLTGQCKCRPHVTGRTCSQP
EQGYFAGLLDYKIYEAEYGGISDRAQLQIREPYRDRDPSWTGPGFVRAVEDSSIQFTLDA
ISQSMEYDLVIRYEPQLSGQWEDVRVVVERPGEVDPDGPCANQFNQQGPPSGGLEISRVS
LPSGARHAVIYPPTCLETGKKYNVRLEFKSYDSNQETPSAAVLIDSITVVPRAGSIPFLG
GSPAADYRRQEFDHYRCAQYFYSVVKTNIPEVCKKHLYSIGFYVLGSGFECQCDPTGSSS
SICDSLGGQCSCKPNVVGRRCDQCAPGTFGFGPEGCSPCECNPVGSLDNFCDSGTGQCRC
RPNTYGRVCDQCQPGYWNFPSCQRCECNGHADLCDSRTGRCLDCRDFTTDDHCDRCLDSY
YGDPRLGVDIPCRACPCPGTIDSGHSYAPRCSLDRETQDVICECQEGYAGPRCDVCADNY
FGNPEVLGGQCRPCQCSNNIDLSRPGNCAGKSGECLQCLFNTEGFSCEVCQKGFFGDALS
QQCTPCVCNLLGSDSSLEGPSVCNRQTGQCPCLPNVEGLSCDRCAVDHWKIASGEGCEAC
SCDPVGSLSTQCNEFDGQCECREGFGGRKCDQCRANYWGNPSDNSCRPCLCDPLGSATQQ
CHHATGACVCLPGMGGEKCDRCARGYVGAIVPDCQPCGECFDNWDRILQELRGQTEQVVV
AAGQIRETGATGAYTREFETMENKLSDVRALLLNTTLSGHELSQLEELFSSIKTNLTMAG
QGMDGLDATVENTTQRVFSVVLALSNLRSKATDLQTAAQSLKNNATKLQEANVEGALNLT
REARQRSQKAQDRVEFTQQPVSDSERQRRRTEALLSRVAPQLGESQQRNAADLADLGGRL
AVIERSLPELNDVVCDGRGDPCDSLCGGGGCGKCGALSCDEGSVTKAENALSLAKEAEGI
LRNRQSESEEMMRGVRQAEVEAEAARVMAREALLAAELAQNRSEAAKAEVDELMNQIDEY
LEQSGASPADIRSLATDVLSKGISLQPEQITDLARRINETISSLTNIDAILAETSGDLAS
AKALKDRADAAKAHAQGILTVAQQVLDSLAAAKAAQDKAEEAIQTADKDISAAELHLTQI
ASETADAQAKASESVQEVEGLRERLKELQRKLIKNERDVKEAARESDVAASLASRAGQGA
SELDTAYQRALKALEEKTARSGDARERSARLQDKANRLSASVFAKVQELKEMEDEYLLHE
RRLTDLSDQVMAMNVRMTDYLQVISDRSEFYRTCQK
Download sequence
Identical sequences E9G6I3
jgi|Dappu1|300823|PASA_GEN_1100127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]