SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|300968|PASA_GEN_11500045 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|300968|PASA_GEN_11500045
Domain Number 1 Region: 94-389
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-27
Family NodB-like polysaccharide deacetylase 0.034
Further Details:      
 
Domain Number 2 Region: 23-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000186
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|300968|PASA_GEN_11500045
Sequence length 469
Sequence
MALTKEKEIGDCEMKRKRRQSEDYVCPVGSGNFADPKSCRRFYQCVEGTPFLSRCPSSLF
FDDIQKLCTFKNEAVCGPVATTPAPVVVDEVDKALKCDSAKCQLPNCFCSRDGTLIPGGL
NPKEIPQMVLISMSDTVNANNYGDFHKVFEGRTNPNGCPVLGTFFVAHEFTNYQNVQQLH
YEGHEIATYSIRKNFDDLSYEEWVQEQIGMREILQNFANVSKLDVFGMRSPHLKPGWNTQ
YEVLVDYGYVWDSSAAVPPLKVPVWPYTLDYAIPHECRSGTCPTRSFPGIWEFPLNSHYV
NSFDGGYCPFMDQCVLHNMDENDVLAWLKEDFARYYDGNRAPYLMAFHTSWFQQKSLVRG
LQLFMDYLTQTPDVWFVTHTQALFWITEPKTIKEMSSVYQPWECKERVVPPQPCNLPSSC
PLSFKGANVTETRYMATCFSCPKVYPWLGDARGAGLSVKDVYKSENPSL
Download sequence
Identical sequences E9HFR8
jgi|Dappu1|300968|PASA_GEN_11500045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]