SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|301004|PASA_GEN_11700004 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|301004|PASA_GEN_11700004
Domain Number - Region: 40-86
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00161
Family Hairpin loop containing domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|301004|PASA_GEN_11700004
Sequence length 314
Sequence
MISKILGCILVPFVVLSIMFDPADAQAWNDGDGGKIKWQFDCDFPGNDIGNQRVPGDQCG
GLCINTNGCNHFSHFYGVCYLKKASSIPPRKQTSGGGGVCGFLTGRVNPGNRNVKGTFWA
EQSDAGGCQMPQGDYVVTDAIALGQSQALGNLKWRQGLCGQVLRIDCGNGPIDAVVASTC
NLNSDSCGVDMIGKTWRRATSNKPPGIVDCSVSLTNRNPLNGNDAICYYRPNSETTNNYF
VILGVVNTGGRISSSAVAAGVTGRRNNDGWFEFNGSGSPIFQSNSEVVFRYEDGSSSSFR
IGNCRNGGQVQIFR
Download sequence
Identical sequences E9HG75
jgi|Dappu1|301004|PASA_GEN_11700004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]