SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|301267|PASA_GEN_12800003 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|301267|PASA_GEN_12800003
Domain Number 1 Region: 405-702
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-77
Family Protein kinases, catalytic subunit 0.000000207
Further Details:      
 
Domain Number 2 Region: 250-345
Classification Level Classification E-value
Superfamily Kringle-like 1.64e-23
Family Kringle modules 0.00096
Further Details:      
 
Domain Number 3 Region: 5-95
Classification Level Classification E-value
Superfamily Immunoglobulin 4.72e-17
Family I set domains 0.039
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|301267|PASA_GEN_12800003
Domain Number - Region: 117-204
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00249
Family Frizzled cysteine-rich domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|301267|PASA_GEN_12800003
Sequence length 885
Sequence
MLKSLSNTTRESGESVKLRCEVSGDPPPNRFRWYKNEAPVLEEKGRVVVRKYRTGSSIHG
SRLRISDVDTHDTGYYKCEASNGKERVESTGIVIVRMGNHPSRLSGEFPSGPLEGFCQVY
RGATCSKFLANRTIFVQSSLTQGIVEEKLAAAFTVIAHSGDLSQSCAEFAVPSLCFAAFP
LCDDQGGKPVPRQLCRDECEVLENDICRMEYAVAKQHPLIGEQVMLPDCEKLPPIGSKGS
ETCFRIGIPHMAQIVEEQSCYNEDGRDYRGIASRTTSKQDCLPWNRQAAVKSADHSELIG
GHNYCRNPGGVEVQPWCFVAGVEGPNSRPRREFCSLPKCSMGYDINWLYIIIPAAAVGLL
VIVILVVCCVRRSKCKAKNSSVMIKGPNSMVSTLQGQSTPSRIHVPEISLHAVRFQHDLG
EGAFGKVRKIKLIYPGQIYLNPGGVMPIAIKTLKANASVKTQQDFRREVELMSELRHPNI
VCLLGVVTRDQPQCMLFEYMAQGDLHEFLVAHSPAGDGSVSGIGAGSDDGTASTLEQSDF
LYIAIQIAAGMEYLASHHYVHRDLAARNCLISDNLIVKISDFGLSRDIYSSDYYRVQGKS
MLPVRWMPPEAILYGKFTIESDVWSFGVVLWEIYSFALQPYYGYNNQDVIDMVRSRQLLS
CPSECPSRIYSLMIECWSEVPLRRPTFTEVHNRLRSWEGLASVGAPSSSIGGPPPIPATL
PPTNGAMLTSRSHSGSHSGSQHSSTGPSNNTGSTNLSGASVHPIISGGNFYHQPGAPYSR
GPVMSPVPSVGGNSASSTYGGTSSVTSSLGCHPAHQPQHQQQQYPVCYAQSIVPGFHSAN
GIRPSGPPSVILHGSSNGNNGWVGRFNTSNAAYSGSSDGGKICNL
Download sequence
Identical sequences E9HHS9
jgi|Dappu1|301267|PASA_GEN_12800003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]