SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|301283|PASA_GEN_12900015 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|301283|PASA_GEN_12900015
Domain Number 1 Region: 31-319
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.35e-28
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|301283|PASA_GEN_12900015
Sequence length 375
Sequence
MQRILAVIFFLAVFHHQSQAQCTTANCVEPACKCMNPSPPGGLSLANTPQLVFLAFDGAI
TTTNYNNYTYMLDKRINPNGCPIGMTFFIFHEYNDYTLTHSLYFKEQEISTHSMSHLTPA
ATWANKSVAEWTDEIGGIQEALAEFANIPIAGIRGARAPFLQSSGDDTFTAMKNLGMFYD
CSFPTTENTNPPVWPYTMDQGFQHECAIPPCPKNKYPGIWTVPMVALNRNDTVCSMADAC
DKPNTLDETYQYLLDNFQRHYTTSKAPFGIYLTANAWFQEADYRLQGYKKFLDTLSTKDD
VYIVPIARGLDWMKNPKPLAEVGNFFSCPPLTQTSCGNYTCSYEGDASPVGPRNMKSCVT
CPDVYPWTGNPLGLP
Download sequence
Identical sequences jgi|Dappu1|301283|PASA_GEN_12900015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]