SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|301668|PASA_GEN_1400144 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|301668|PASA_GEN_1400144
Domain Number 1 Region: 170-309
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000101
Family C-type lectin domain 0.0061
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|301668|PASA_GEN_1400144
Domain Number - Region: 9-149
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0106
Family C-type lectin domain 0.031
Further Details:      
 
Domain Number - Region: 112-154
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0174
Family C-type lectin domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|301668|PASA_GEN_1400144
Sequence length 429
Sequence
MKPRKEEPKCFHGFEHANDGQCYLKTEASTFATAFAKCWAGWPIQPEILEPKSLSYWFQN
SRDGIYKIQSTASGFVWLPFRHFNKDTPLLNPPWSWNAVSNRWVHQVNELDIRADNNSDG
EELCAAYDLTRNRMVTRSCQDYLPMICSRPALPPNISSIISSQPDHTGEYFCEQGWITHF
LVMDAGMCYRRFTLKEAVDADGAQQFCIKQGGHLAVAPTHNMRIALEQVYGFFNNQSIVD
SWIGLRNRGEHPVTFNWVNQTAGVSTSTALNWQPYQEFGSGYGVSTGLTRAWWNWPRETK
IWGVLCQKTVSDWQDGIGLQLEKLSVNEYALVFTYDQRHYGPPGEQYSHVSKTFWQSDFD
VICHFNNYAMHFRFPLDRQYYRVLVPGSMGSGRLICEGWLNRPTLRFQSNTVIHRPTYDY
DSEEYKPYP
Download sequence
Identical sequences E9GAB1
jgi|Dappu1|301668|PASA_GEN_1400144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]