SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|301778|PASA_GEN_14500005 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|301778|PASA_GEN_14500005
Domain Number - Region: 68-129
Classification Level Classification E-value
Superfamily HMG-box 0.000641
Family HMG-box 0.0065
Further Details:      
 
Domain Number - Region: 1-23
Classification Level Classification E-value
Superfamily HMG-box 0.00524
Family HMG-box 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|301778|PASA_GEN_14500005
Sequence length 168
Sequence
MWRSLTEEKKIPYAEAAKRRNDAQQMERQKIDEKIIQLRPGARDYRGYKITPLPSNLLEK
DKVIASKRGLNPVSWYHWSEHQKNVQNPNYIWKNYYLRITIEANSTWPSLTEQQKKMFIH
RAKVEYRKFTGSDEGNEVIDSILKESLEEHAACGYGKRLATEYSSDTD
Download sequence
Identical sequences E9HK66
jgi|Dappu1|301778|PASA_GEN_14500005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]